Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4814258..4814860 | Replicon | chromosome |
| Accession | NZ_CP116136 | ||
| Organism | Escherichia coli strain DETEC-P649 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PIB66_RS22830 | Protein ID | WP_000897305.1 |
| Coordinates | 4814549..4814860 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIB66_RS22825 | Protein ID | WP_000356395.1 |
| Coordinates | 4814258..4814548 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB66_RS22790 (4809882) | 4809882..4810784 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| PIB66_RS22795 (4810781) | 4810781..4811416 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PIB66_RS22800 (4811413) | 4811413..4812342 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| PIB66_RS22805 (4812524) | 4812524..4812766 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| PIB66_RS22810 (4812985) | 4812985..4813203 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| PIB66_RS22815 (4813622) | 4813622..4813900 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| PIB66_RS22820 (4813952) | 4813952..4814173 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| PIB66_RS22825 (4814258) | 4814258..4814548 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| PIB66_RS22830 (4814549) | 4814549..4814860 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PIB66_RS22835 (4815089) | 4815089..4815997 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| PIB66_RS22840 (4816165) | 4816165..4817079 | - | 915 | WP_109553727.1 | transposase | - |
| PIB66_RS22845 (4817092) | 4817092..4817979 | - | 888 | Protein_4463 | hypothetical protein | - |
| PIB66_RS22850 (4818395) | 4818395..4819336 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PIB66_RS22855 (4819381) | 4819381..4819818 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268140 WP_000897305.1 NZ_CP116136:c4814860-4814549 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|