Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3893617..3894311 Replicon chromosome
Accession NZ_CP116136
Organism Escherichia coli strain DETEC-P649

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag PIB66_RS18540 Protein ID WP_001263491.1
Coordinates 3893617..3894015 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag PIB66_RS18545 Protein ID WP_000554755.1
Coordinates 3894018..3894311 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3889446) 3889446..3889526 - 81 NuclAT_10 - -
- (3889446) 3889446..3889526 - 81 NuclAT_10 - -
- (3889446) 3889446..3889526 - 81 NuclAT_10 - -
- (3889446) 3889446..3889526 - 81 NuclAT_10 - -
PIB66_RS18510 (3888786) 3888786..3890030 - 1245 WP_000189541.1 esterase FrsA -
PIB66_RS18515 (3890122) 3890122..3890580 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PIB66_RS18520 (3890841) 3890841..3892298 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
PIB66_RS18525 (3892355) 3892355..3892707 - 353 Protein_3626 peptide chain release factor H -
PIB66_RS18530 (3892703) 3892703..3892909 - 207 Protein_3627 RtcB family protein -
PIB66_RS18535 (3893155) 3893155..3893607 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
PIB66_RS18540 (3893617) 3893617..3894015 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PIB66_RS18545 (3894018) 3894018..3894311 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PIB66_RS18550 (3894363) 3894363..3895418 - 1056 WP_001550655.1 DNA polymerase IV -
PIB66_RS18555 (3895489) 3895489..3896274 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
PIB66_RS18560 (3896246) 3896246..3897958 + 1713 Protein_3633 flagellar biosynthesis protein FlhA -
PIB66_RS18565 (3898063) 3898063..3898341 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
PIB66_RS18570 (3898334) 3898334..3898690 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3883553..3894311 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T268135 WP_001263491.1 NZ_CP116136:c3894015-3893617 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT268135 WP_000554755.1 NZ_CP116136:c3894311-3894018 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References