Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1222807..1223534 | Replicon | chromosome |
Accession | NZ_CP116136 | ||
Organism | Escherichia coli strain DETEC-P649 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | PIB66_RS05925 | Protein ID | WP_000547555.1 |
Coordinates | 1222807..1223118 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIB66_RS05930 | Protein ID | WP_000126294.1 |
Coordinates | 1223115..1223534 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB66_RS05900 (1218742) | 1218742..1220451 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
PIB66_RS05905 (1220461) | 1220461..1221003 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
PIB66_RS05910 (1221003) | 1221003..1221770 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
PIB66_RS05915 (1221767) | 1221767..1222177 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
PIB66_RS05920 (1222170) | 1222170..1222640 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
PIB66_RS05925 (1222807) | 1222807..1223118 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PIB66_RS05930 (1223115) | 1223115..1223534 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
PIB66_RS05935 (1223613) | 1223613..1225037 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
PIB66_RS05940 (1225046) | 1225046..1226503 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
PIB66_RS05945 (1226763) | 1226763..1227773 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
PIB66_RS05950 (1227922) | 1227922..1228449 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T268124 WP_000547555.1 NZ_CP116136:1222807-1223118 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT268124 WP_000126294.1 NZ_CP116136:1223115-1223534 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|