Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61267..61596 | Replicon | plasmid pDETEC32 |
| Accession | NZ_CP116124 | ||
| Organism | Escherichia coli strain DETEC-P666 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIB57_RS24160 | Protein ID | WP_001372321.1 |
| Coordinates | 61267..61392 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 61469..61596 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB57_RS24110 (57163) | 57163..57555 | - | 393 | WP_000659962.1 | F-type conjugal transfer protein TrbF | - |
| PIB57_RS24115 (57536) | 57536..57883 | - | 348 | WP_071571857.1 | P-type conjugative transfer protein TrbJ | - |
| PIB57_RS24120 (57813) | 57813..58358 | - | 546 | WP_000059829.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| PIB57_RS24125 (58345) | 58345..58629 | - | 285 | WP_001617873.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| PIB57_RS24130 (58756) | 58756..59076 | - | 321 | WP_001348757.1 | conjugal transfer protein TrbA | - |
| PIB57_RS24140 (60058) | 60058..60345 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| PIB57_RS24145 (60370) | 60370..60576 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| PIB57_RS24150 (60646) | 60646..60819 | + | 174 | Protein_70 | hypothetical protein | - |
| PIB57_RS24155 (60817) | 60817..61047 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| PIB57_RS24160 (61267) | 61267..61392 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIB57_RS24165 (61334) | 61334..61483 | - | 150 | Protein_73 | plasmid maintenance protein Mok | - |
| - (61469) | 61469..61596 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (61469) | 61469..61596 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (61469) | 61469..61596 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (61469) | 61469..61596 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (63038) | 63038..63140 | - | 103 | NuclAT_1 | - | - |
| - (63038) | 63038..63140 | - | 103 | NuclAT_1 | - | - |
| - (63038) | 63038..63140 | - | 103 | NuclAT_1 | - | - |
| - (63038) | 63038..63140 | - | 103 | NuclAT_1 | - | - |
| PIB57_RS24175 (63109) | 63109..63871 | - | 763 | Protein_75 | plasmid SOS inhibition protein A | - |
| PIB57_RS24180 (63868) | 63868..64302 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| PIB57_RS24185 (64357) | 64357..66315 | - | 1959 | WP_113519520.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B | - | 1..98478 | 98478 | |
| - | inside | IScluster/Tn | - | - | 59124..62992 | 3868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268110 WP_001372321.1 NZ_CP116124:c61392-61267 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 128 bp
>AT268110 NZ_CP116124:c61596-61469 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
