Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40532..40771 Replicon plasmid pDETEC32
Accession NZ_CP116124
Organism Escherichia coli strain DETEC-P666

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag PIB57_RS24050 Protein ID WP_023144756.1
Coordinates 40532..40666 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 40711..40771 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB57_RS24020 (36552) 36552..36953 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
PIB57_RS24025 (36886) 36886..37143 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
PIB57_RS24030 (37236) 37236..37889 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
PIB57_RS24035 (38829) 38829..39677 - 849 WP_139471275.1 incFII family plasmid replication initiator RepA -
PIB57_RS24040 (39670) 39670..39744 - 75 WP_031943482.1 RepA leader peptide Tap -
PIB57_RS24045 (39981) 39981..40235 - 255 WP_000083850.1 replication regulatory protein RepA -
PIB57_RS24050 (40532) 40532..40666 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (40711) 40711..40771 + 61 NuclAT_2 - Antitoxin
- (40711) 40711..40771 + 61 NuclAT_2 - Antitoxin
- (40711) 40711..40771 + 61 NuclAT_2 - Antitoxin
- (40711) 40711..40771 + 61 NuclAT_2 - Antitoxin
PIB57_RS24055 (40738) 40738..41024 - 287 Protein_51 DUF2726 domain-containing protein -
PIB57_RS24060 (41537) 41537..41749 - 213 WP_013023861.1 hypothetical protein -
PIB57_RS24065 (41880) 41880..42440 - 561 WP_000139341.1 fertility inhibition protein FinO -
PIB57_RS24070 (42495) 42495..43241 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B - 1..98478 98478


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T268109 WP_023144756.1 NZ_CP116124:c40666-40532 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT268109 NZ_CP116124:40711-40771 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References