Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40696..40960 Replicon plasmid pDETEC14
Accession NZ_CP116117
Organism Escherichia coli strain DETEC-P793

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PIC92_RS25850 Protein ID WP_001331364.1
Coordinates 40808..40960 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40696..40758 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC92_RS25835 (35935) 35935..38226 - 2292 WP_021520372.1 F-type conjugative transfer protein TrbC -
PIC92_RS25840 (38219) 38219..39289 - 1071 WP_001542508.1 IncI1-type conjugal transfer protein TrbB -
PIC92_RS25845 (39308) 39308..40516 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (40696) 40696..40758 - 63 NuclAT_0 - Antitoxin
- (40696) 40696..40758 - 63 NuclAT_0 - Antitoxin
- (40696) 40696..40758 - 63 NuclAT_0 - Antitoxin
- (40696) 40696..40758 - 63 NuclAT_0 - Antitoxin
PIC92_RS25850 (40808) 40808..40960 + 153 WP_001331364.1 Hok/Gef family protein Toxin
PIC92_RS25855 (41032) 41032..41283 - 252 WP_255081991.1 hypothetical protein -
PIC92_RS25860 (41784) 41784..41879 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PIC92_RS25865 (41944) 41944..42120 - 177 WP_001054904.1 hypothetical protein -
PIC92_RS25870 (42512) 42512..42721 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PIC92_RS25875 (42793) 42793..43443 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
PIC92_RS25880 (43517) 43517..45685 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87921 87921


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T268077 WP_001331364.1 NZ_CP116117:40808-40960 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT268077 NZ_CP116117:c40758-40696 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References