Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4037145..4037838 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PIC92_RS19780 | Protein ID | WP_000415584.1 |
Coordinates | 4037542..4037838 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PIC92_RS19775 | Protein ID | WP_000650107.1 |
Coordinates | 4037145..4037540 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS19765 (4033009) | 4033009..4035267 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
PIC92_RS19770 (4035405) | 4035405..4037012 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PIC92_RS19775 (4037145) | 4037145..4037540 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PIC92_RS19780 (4037542) | 4037542..4037838 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PIC92_RS19785 (4038043) | 4038043..4038525 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PIC92_RS19790 (4038578) | 4038578..4038970 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PIC92_RS19795 (4039122) | 4039122..4039781 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
PIC92_RS19800 (4039778) | 4039778..4041127 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PIC92_RS19805 (4041173) | 4041173..4041505 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
PIC92_RS19810 (4041824) | 4041824..4042405 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
PIC92_RS19815 (4042436) | 4042436..4042750 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4028682..4037838 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T268072 WP_000415584.1 NZ_CP116115:c4037838-4037542 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT268072 WP_000650107.1 NZ_CP116115:c4037540-4037145 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|