Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1247394..1248073 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | PIC92_RS05995 | Protein ID | WP_000057523.1 |
Coordinates | 1247394..1247696 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | PIC92_RS06000 | Protein ID | WP_000806442.1 |
Coordinates | 1247732..1248073 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS05975 (1242657) | 1242657..1243877 | - | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
PIC92_RS05980 (1244095) | 1244095..1245747 | + | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
PIC92_RS05985 (1245784) | 1245784..1246263 | - | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
PIC92_RS05990 (1246467) | 1246467..1247261 | - | 795 | WP_001538398.1 | TraB/GumN family protein | - |
PIC92_RS05995 (1247394) | 1247394..1247696 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PIC92_RS06000 (1247732) | 1247732..1248073 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
PIC92_RS06005 (1248131) | 1248131..1250635 | - | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
PIC92_RS06010 (1250897) | 1250897..1251829 | + | 933 | WP_001538399.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T268063 WP_000057523.1 NZ_CP116115:1247394-1247696 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|