Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1004268..1004962 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PIC92_RS04860 | Protein ID | WP_001263500.1 |
Coordinates | 1004564..1004962 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC92_RS04855 | Protein ID | WP_000554758.1 |
Coordinates | 1004268..1004561 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS04830 (1000085) | 1000085..1000552 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
PIC92_RS04835 (1000572) | 1000572..1001288 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
PIC92_RS04840 (1001301) | 1001301..1002164 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
PIC92_RS04845 (1002167) | 1002167..1003090 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC92_RS04850 (1003161) | 1003161..1004216 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
PIC92_RS04855 (1004268) | 1004268..1004561 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC92_RS04860 (1004564) | 1004564..1004962 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC92_RS04865 (1004972) | 1004972..1005424 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
PIC92_RS04870 (1005614) | 1005614..1006753 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
PIC92_RS04875 (1006750) | 1006750..1007364 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
PIC92_RS04880 (1007421) | 1007421..1008878 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
PIC92_RS04885 (1009139) | 1009139..1009597 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T268061 WP_001263500.1 NZ_CP116115:1004564-1004962 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|