Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 692913..693171 | Replicon | chromosome |
| Accession | NZ_CP116115 | ||
| Organism | Escherichia coli strain DETEC-P793 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PIC92_RS03380 | Protein ID | WP_000809168.1 |
| Coordinates | 692913..693065 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 693114..693171 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC92_RS03360 | 688158..688871 | - | 714 | WP_001102391.1 | acidic protein MsyB | - |
| PIC92_RS03365 | 688897..689301 | - | 405 | WP_000843687.1 | DUF2541 family protein | - |
| PIC92_RS03370 | 689673..691589 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PIC92_RS03375 | 691678..692808 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| PIC92_RS03380 | 692913..693065 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 693114..693171 | + | 58 | - | - | Antitoxin |
| PIC92_RS03385 | 693680..694441 | + | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
| PIC92_RS03390 | 694461..695954 | + | 1494 | WP_001774152.1 | sulfatase-like hydrolase/transferase | - |
| PIC92_RS03395 | 696083..697342 | + | 1260 | WP_000494929.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T268059 WP_000809168.1 NZ_CP116115:c693065-692913 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT268059 NZ_CP116115:693114-693171 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|