Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
| Location | 613066..613478 | Replicon | chromosome |
| Accession | NZ_CP116115 | ||
| Organism | Escherichia coli strain DETEC-P793 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | PIC92_RS02980 | Protein ID | WP_000132614.1 |
| Coordinates | 613066..613407 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 613402..613478 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC92_RS02955 (608135) | 608135..609415 | - | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
| PIC92_RS02960 (609600) | 609600..610520 | + | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| PIC92_RS02965 (610748) | 610748..610828 | + | 81 | WP_020233658.1 | hypothetical protein | - |
| PIC92_RS02970 (610926) | 610926..611802 | + | 877 | Protein_576 | DUF262 domain-containing protein | - |
| PIC92_RS02975 (611856) | 611856..613019 | + | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
| PIC92_RS02980 (613066) | 613066..613407 | - | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_8 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_8 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_8 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_8 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (613402) | 613402..613478 | + | 77 | NuclAT_9 | - | Antitoxin |
| PIC92_RS02985 (613628) | 613628..615397 | - | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
| PIC92_RS02990 (615397) | 615397..616866 | - | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T268055 WP_000132614.1 NZ_CP116115:c613407-613066 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT268055 NZ_CP116115:613402-613478 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|