Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72746..73010 | Replicon | plasmid pDETEC20 |
| Accession | NZ_CP116112 | ||
| Organism | Escherichia coli strain DETEC-P80 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | PIC84_RS24245 | Protein ID | WP_001303307.1 |
| Coordinates | 72858..73010 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 72746..72808 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC84_RS24230 (68848) | 68848..69918 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| PIC84_RS24235 (69937) | 69937..71145 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (71325) | 71325..71385 | - | 61 | NuclAT_1 | - | - |
| - (71325) | 71325..71385 | - | 61 | NuclAT_1 | - | - |
| - (71325) | 71325..71385 | - | 61 | NuclAT_1 | - | - |
| - (71325) | 71325..71385 | - | 61 | NuclAT_1 | - | - |
| PIC84_RS24240 (71452) | 71452..72537 | - | 1086 | WP_000080543.1 | protein finQ | - |
| - (72746) | 72746..72808 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (72746) | 72746..72808 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (72746) | 72746..72808 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (72746) | 72746..72808 | - | 63 | NuclAT_0 | - | Antitoxin |
| PIC84_RS24245 (72858) | 72858..73010 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| PIC84_RS24250 (73082) | 73082..73333 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (73720) | 73720..73771 | - | 52 | NuclAT_2 | - | - |
| - (73720) | 73720..73771 | - | 52 | NuclAT_2 | - | - |
| - (73720) | 73720..73771 | - | 52 | NuclAT_2 | - | - |
| - (73720) | 73720..73771 | - | 52 | NuclAT_2 | - | - |
| PIC84_RS24255 (74257) | 74257..74433 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| PIC84_RS24260 (74642) | 74642..74851 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| PIC84_RS24265 (74949) | 74949..75563 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PIC84_RS24270 (75639) | 75639..77807 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / aac(3)-IId / ant(3'')-Ia / erm(B) | - | 1..118716 | 118716 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T268045 WP_001303307.1 NZ_CP116112:72858-73010 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT268045 NZ_CP116112:c72808-72746 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
