Detailed information of TA system TA268042

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 117341..117767
• Replicon: plasmid pDETEC19
• Accession: NZ_CP116111
• Organism: Escherichia coli strain DETEC-P80

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC84_RS23585
• Protein ID: WP_001372321.1
• Coordinates: 117341..117466 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	117543..117767 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC84_RS23545 (112715)	112715..113404	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIC84_RS23550 (113591)	113591..113974	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC84_RS23555 (114295)	114295..114897	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PIC84_RS23560 (115194)	115194..116015	-	822	WP_001234426.1	DUF932 domain-containing protein	-
PIC84_RS23565 (116133)	116133..116420	-	288	WP_000107535.1	hypothetical protein	-
PIC84_RS23570 (116445)	116445..116651	-	207	WP_000547968.1	hypothetical protein	-
PIC84_RS23575 (116721)	116721..116893	+	173	Protein_129	hypothetical protein	-
PIC84_RS23580 (116891)	116891..117121	-	231	WP_071586998.1	hypothetical protein	-
PIC84_RS23585 (117341)	117341..117466	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC84_RS23590 (117408)	117408..117557	-	150	Protein_132	plasmid maintenance protein Mok	-
- (117543)	117543..117767	-	225	NuclAT_0	-	Antitoxin
- (117543)	117543..117767	-	225	NuclAT_0	-	Antitoxin
- (117543)	117543..117767	-	225	NuclAT_0	-	Antitoxin
- (117543)	117543..117767	-	225	NuclAT_0	-	Antitoxin
PIC84_RS23595 (117579)	117579..117767	+	189	WP_001299721.1	hypothetical protein	-
PIC84_RS23600 (117736)	117736..118498	-	763	Protein_134	plasmid SOS inhibition protein A	-
PIC84_RS23605 (118495)	118495..118929	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PIC84_RS23610 (118984)	118984..119181	-	198	Protein_136	hypothetical protein	-
PIC84_RS23615 (119209)	119209..119442	-	234	WP_000005987.1	DUF905 family protein	-
PIC84_RS23620 (119510)	119510..120049	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
PIC84_RS23625 (120075)	120075..120281	-	207	WP_000275856.1	hypothetical protein	-
PIC84_RS23630 (120351)	120351..120431	+	81	Protein_140	hypothetical protein	-
PIC84_RS23635 (120614)	120614..120783	-	170	Protein_141	hypothetical protein	-
PIC84_RS23640 (121377)	121377..122348	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / oqxA / oqxB / aac(3)-IIa / mph(A) / sul1 / qacE / aadA5 / blaTEM-1B / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..159559	159559

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268042 WP_001372321.1 NZ_CP116111:c117466-117341 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268042 NZ_CP116111:c117767-117543 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin