Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79012..79266 | Replicon | plasmid pDETEC19 |
| Accession | NZ_CP116111 | ||
| Organism | Escherichia coli strain DETEC-P80 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC84_RS23350 | Protein ID | WP_001312851.1 |
| Coordinates | 79012..79161 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79205..79266 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC84_RS23305 (74564) | 74564..74965 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PIC84_RS23310 (74898) | 74898..75155 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PIC84_RS23315 (75248) | 75248..75901 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PIC84_RS23320 (75999) | 75999..76139 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| PIC84_RS23325 (76840) | 76840..77697 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PIC84_RS23330 (77690) | 77690..78172 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC84_RS23335 (78165) | 78165..78212 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC84_RS23340 (78203) | 78203..78454 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC84_RS23345 (78471) | 78471..78728 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC84_RS23350 (79012) | 79012..79161 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79205) | 79205..79266 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79205) | 79205..79266 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79205) | 79205..79266 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79205) | 79205..79266 | + | 62 | NuclAT_1 | - | Antitoxin |
| PIC84_RS23355 (79522) | 79522..79596 | - | 75 | Protein_85 | endonuclease | - |
| PIC84_RS23360 (79842) | 79842..80054 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC84_RS23365 (80190) | 80190..80750 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC84_RS23370 (80853) | 80853..81713 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| PIC84_RS23375 (81772) | 81772..82518 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / oqxA / oqxB / aac(3)-IIa / mph(A) / sul1 / qacE / aadA5 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..159559 | 159559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T268037 WP_001312851.1 NZ_CP116111:c79161-79012 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT268037 NZ_CP116111:79205-79266 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
