Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3644142..3644836 | Replicon | chromosome |
| Accession | NZ_CP116110 | ||
| Organism | Escherichia coli strain DETEC-P80 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | PIC84_RS18015 | Protein ID | WP_001263489.1 |
| Coordinates | 3644142..3644540 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PIC84_RS18020 | Protein ID | WP_000554758.1 |
| Coordinates | 3644543..3644836 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3639730) | 3639730..3639810 | - | 81 | NuclAT_10 | - | - |
| - (3639730) | 3639730..3639810 | - | 81 | NuclAT_10 | - | - |
| - (3639730) | 3639730..3639810 | - | 81 | NuclAT_10 | - | - |
| - (3639730) | 3639730..3639810 | - | 81 | NuclAT_10 | - | - |
| PIC84_RS17990 (3640406) | 3640406..3640864 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| PIC84_RS17995 (3641125) | 3641125..3642582 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| PIC84_RS18000 (3642639) | 3642639..3643160 | - | 522 | Protein_3520 | peptide chain release factor H | - |
| PIC84_RS18005 (3643156) | 3643156..3643362 | - | 207 | Protein_3521 | RtcB family protein | - |
| PIC84_RS18010 (3643680) | 3643680..3644132 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| PIC84_RS18015 (3644142) | 3644142..3644540 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PIC84_RS18020 (3644543) | 3644543..3644836 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PIC84_RS18025 (3644888) | 3644888..3645943 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| PIC84_RS18030 (3646014) | 3646014..3646799 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| PIC84_RS18035 (3646771) | 3646771..3648483 | + | 1713 | Protein_3527 | flagellar biosynthesis protein FlhA | - |
| PIC84_RS18040 (3648707) | 3648707..3649204 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T268033 WP_001263489.1 NZ_CP116110:c3644540-3644142 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |