Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 72847..73111 Replicon plasmid pDETEC67
Accession NZ_CP116109
Organism Escherichia coli strain DETEC-P829

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PIC05_RS26360 Protein ID WP_001331364.1
Coordinates 72959..73111 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 72847..72904 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC05_RS26345 (68086) 68086..70377 - 2292 WP_001289272.1 F-type conjugative transfer protein TrbC -
PIC05_RS26350 (70370) 70370..71440 - 1071 WP_001535705.1 IncI1-type conjugal transfer protein TrbB -
PIC05_RS26355 (71459) 71459..72667 - 1209 WP_001535704.1 IncI1-type conjugal transfer protein TrbA -
- (72847) 72847..72904 - 58 NuclAT_0 - Antitoxin
- (72847) 72847..72904 - 58 NuclAT_0 - Antitoxin
- (72847) 72847..72904 - 58 NuclAT_0 - Antitoxin
- (72847) 72847..72904 - 58 NuclAT_0 - Antitoxin
PIC05_RS26360 (72959) 72959..73111 + 153 WP_001331364.1 Hok/Gef family protein Toxin
PIC05_RS26365 (73183) 73183..73434 - 252 WP_001535703.1 hypothetical protein -
PIC05_RS26370 (73935) 73935..74030 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PIC05_RS26375 (74095) 74095..74271 - 177 WP_271292889.1 hypothetical protein -
PIC05_RS26380 (74480) 74480..74689 - 210 WP_001140545.1 hemolysin expression modulator Hha -
PIC05_RS26385 (74787) 74787..75401 - 615 WP_000578649.1 plasmid IncI1-type surface exclusion protein ExcA -
PIC05_RS26390 (75477) 75477..77645 - 2169 WP_000698360.1 IncI1-type conjugal transfer membrane protein TraY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..118588 118588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T268015 WP_001331364.1 NZ_CP116109:72959-73111 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT268015 NZ_CP116109:c72904-72847 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References