Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 133384..133810 | Replicon | plasmid pDETEC66 |
| Accession | NZ_CP116108 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIC05_RS25590 | Protein ID | WP_096937776.1 |
| Coordinates | 133384..133509 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 133586..133810 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS25555 (128557) | 128557..128958 | - | 402 | WP_001369361.1 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
| PIC05_RS25560 (129051) | 129051..129740 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| PIC05_RS25565 (129927) | 129927..130310 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIC05_RS25570 (130631) | 130631..131233 | + | 603 | WP_077250849.1 | transglycosylase SLT domain-containing protein | - |
| PIC05_RS25575 (131530) | 131530..132351 | - | 822 | WP_001234487.1 | DUF932 domain-containing protein | - |
| PIC05_RS25580 (132462) | 132462..132758 | - | 297 | WP_001272245.1 | hypothetical protein | - |
| PIC05_RS25585 (132810) | 132810..133083 | + | 274 | Protein_145 | hypothetical protein | - |
| PIC05_RS25590 (133384) | 133384..133509 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIC05_RS25595 (133451) | 133451..133600 | - | 150 | Protein_147 | plasmid maintenance protein Mok | - |
| - (133586) | 133586..133810 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (133586) | 133586..133810 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (133586) | 133586..133810 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (133586) | 133586..133810 | - | 225 | NuclAT_0 | - | Antitoxin |
| PIC05_RS25600 (133779) | 133779..134541 | - | 763 | Protein_148 | plasmid SOS inhibition protein A | - |
| PIC05_RS25605 (134538) | 134538..134972 | - | 435 | WP_000845962.1 | conjugation system SOS inhibitor PsiB | - |
| PIC05_RS25610 (135041) | 135041..137005 | - | 1965 | WP_001593049.1 | ParB/RepB/Spo0J family partition protein | - |
| PIC05_RS25615 (137064) | 137064..137297 | - | 234 | WP_000005985.1 | DUF905 family protein | - |
| PIC05_RS25620 (137355) | 137355..137894 | - | 540 | WP_072647559.1 | single-stranded DNA-binding protein | - |
| PIC05_RS25625 (137920) | 137920..138126 | - | 207 | WP_000547969.1 | hypothetical protein | - |
| PIC05_RS25630 (138196) | 138196..138276 | + | 81 | Protein_154 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..194772 | 194772 | |
| - | flank | IS/Tn | - | - | 138447..139418 | 971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T268009 WP_096937776.1 NZ_CP116108:c133509-133384 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT268009 NZ_CP116108:c133810-133586 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|