Detailed information of TA system TA268009

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 133384..133810
• Replicon: plasmid pDETEC66
• Accession: NZ_CP116108
• Organism: Escherichia coli strain DETEC-P829

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC05_RS25590
• Protein ID: WP_096937776.1
• Coordinates: 133384..133509 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	133586..133810 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC05_RS25555 (128557)	128557..128958	-	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-
PIC05_RS25560 (129051)	129051..129740	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIC05_RS25565 (129927)	129927..130310	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC05_RS25570 (130631)	130631..131233	+	603	WP_077250849.1	transglycosylase SLT domain-containing protein	-
PIC05_RS25575 (131530)	131530..132351	-	822	WP_001234487.1	DUF932 domain-containing protein	-
PIC05_RS25580 (132462)	132462..132758	-	297	WP_001272245.1	hypothetical protein	-
PIC05_RS25585 (132810)	132810..133083	+	274	Protein_145	hypothetical protein	-
PIC05_RS25590 (133384)	133384..133509	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC05_RS25595 (133451)	133451..133600	-	150	Protein_147	plasmid maintenance protein Mok	-
- (133586)	133586..133810	-	225	NuclAT_0	-	Antitoxin
- (133586)	133586..133810	-	225	NuclAT_0	-	Antitoxin
- (133586)	133586..133810	-	225	NuclAT_0	-	Antitoxin
- (133586)	133586..133810	-	225	NuclAT_0	-	Antitoxin
PIC05_RS25600 (133779)	133779..134541	-	763	Protein_148	plasmid SOS inhibition protein A	-
PIC05_RS25605 (134538)	134538..134972	-	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
PIC05_RS25610 (135041)	135041..137005	-	1965	WP_001593049.1	ParB/RepB/Spo0J family partition protein	-
PIC05_RS25615 (137064)	137064..137297	-	234	WP_000005985.1	DUF905 family protein	-
PIC05_RS25620 (137355)	137355..137894	-	540	WP_072647559.1	single-stranded DNA-binding protein	-
PIC05_RS25625 (137920)	137920..138126	-	207	WP_000547969.1	hypothetical protein	-
PIC05_RS25630 (138196)	138196..138276	+	81	Protein_154	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA	1..194772	194772
	-	flank	IS/Tn	-	-	138447..139418	971

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T268009 WP_096937776.1 NZ_CP116108:c133509-133384 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268009 NZ_CP116108:c133810-133586 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin