Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95762..96016 | Replicon | plasmid pDETEC66 |
| Accession | NZ_CP116108 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC05_RS25365 | Protein ID | WP_001312851.1 |
| Coordinates | 95762..95911 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 95955..96016 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS25320 (91305) | 91305..91652 | + | 348 | Protein_92 | IS1-like element IS1A family transposase | - |
| PIC05_RS25325 (91668) | 91668..91988 | - | 321 | Protein_93 | serine acetyltransferase | - |
| PIC05_RS25330 (92092) | 92092..92379 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PIC05_RS25335 (92376) | 92376..92627 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PIC05_RS25340 (93590) | 93590..94447 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PIC05_RS25345 (94440) | 94440..94922 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC05_RS25350 (94915) | 94915..94962 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC05_RS25355 (94953) | 94953..95204 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC05_RS25360 (95221) | 95221..95478 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC05_RS25365 (95762) | 95762..95911 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (95955) | 95955..96016 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (95955) | 95955..96016 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (95955) | 95955..96016 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (95955) | 95955..96016 | + | 62 | NuclAT_1 | - | Antitoxin |
| PIC05_RS25370 (96272) | 96272..96346 | - | 75 | Protein_102 | endonuclease | - |
| PIC05_RS25375 (96592) | 96592..96804 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC05_RS25380 (96940) | 96940..97500 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC05_RS25385 (97603) | 97603..98463 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| PIC05_RS25390 (98522) | 98522..99265 | - | 744 | WP_271292885.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..194772 | 194772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T268004 WP_001312851.1 NZ_CP116108:c95911-95762 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT268004 NZ_CP116108:95955-96016 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
