Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4646116..4646718 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PIC05_RS22440 | Protein ID | WP_000897305.1 |
| Coordinates | 4646407..4646718 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIC05_RS22435 | Protein ID | WP_000356397.1 |
| Coordinates | 4646116..4646406 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS22410 (4642042) | 4642042..4642944 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| PIC05_RS22415 (4642941) | 4642941..4643576 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PIC05_RS22420 (4643573) | 4643573..4644502 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PIC05_RS22425 (4644832) | 4644832..4645074 | - | 243 | WP_001086388.1 | protein YiiF | - |
| PIC05_RS22430 (4645293) | 4645293..4645511 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| PIC05_RS22435 (4646116) | 4646116..4646406 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PIC05_RS22440 (4646407) | 4646407..4646718 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PIC05_RS22445 (4646947) | 4646947..4647855 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| PIC05_RS22450 (4647919) | 4647919..4648860 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PIC05_RS22455 (4648905) | 4648905..4649342 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PIC05_RS22460 (4649339) | 4649339..4650211 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PIC05_RS22465 (4650205) | 4650205..4650804 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
| PIC05_RS22470 (4650903) | 4650903..4651688 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268001 WP_000897305.1 NZ_CP116106:c4646718-4646407 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|