Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 590996..591795 | Replicon | chromosome |
Accession | NZ_CP116106 | ||
Organism | Escherichia coli strain DETEC-P829 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | PIC05_RS02900 | Protein ID | WP_000347267.1 |
Coordinates | 590996..591460 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PIC05_RS02905 | Protein ID | WP_001307405.1 |
Coordinates | 591460..591795 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC05_RS02870 (585997) | 585997..586431 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PIC05_RS02875 (586449) | 586449..587327 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIC05_RS02880 (587317) | 587317..588096 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIC05_RS02885 (588107) | 588107..588580 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIC05_RS02890 (588603) | 588603..589883 | - | 1281 | WP_000681947.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIC05_RS02895 (590132) | 590132..590941 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
PIC05_RS02900 (590996) | 590996..591460 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIC05_RS02905 (591460) | 591460..591795 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIC05_RS02910 (591944) | 591944..593515 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
PIC05_RS02915 (593890) | 593890..595224 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIC05_RS02920 (595240) | 595240..596010 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T267986 WP_000347267.1 NZ_CP116106:c591460-590996 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |