Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1003368..1004062 | Replicon | chromosome |
| Accession | NZ_CP116103 | ||
| Organism | Escherichia coli strain DETEC-P836 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PIB67_RS04840 | Protein ID | WP_001263500.1 |
| Coordinates | 1003664..1004062 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PIB67_RS04835 | Protein ID | WP_000554758.1 |
| Coordinates | 1003368..1003661 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB67_RS04810 (999185) | 999185..999652 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
| PIB67_RS04815 (999672) | 999672..1000388 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| PIB67_RS04820 (1000401) | 1000401..1001264 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| PIB67_RS04825 (1001267) | 1001267..1002190 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| PIB67_RS04830 (1002261) | 1002261..1003316 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| PIB67_RS04835 (1003368) | 1003368..1003661 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PIB67_RS04840 (1003664) | 1003664..1004062 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PIB67_RS04845 (1004072) | 1004072..1004524 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| PIB67_RS04850 (1004714) | 1004714..1005853 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| PIB67_RS04855 (1005850) | 1005850..1006464 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
| PIB67_RS04860 (1006521) | 1006521..1007978 | - | 1458 | WP_271291445.1 | cytosol nonspecific dipeptidase | - |
| PIB67_RS04865 (1008239) | 1008239..1008697 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T267966 WP_001263500.1 NZ_CP116103:1003664-1004062 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|