Detailed information of TA system TA267950

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 113984..114405
• Replicon: plasmid pDETEC23
• Accession: NZ_CP116101
• Organism: Escherichia coli strain DETEC-P881

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC52_RS23305
• Protein ID: WP_096937776.1
• Coordinates: 113984..114109 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	114207..114405 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC52_RS23265 (109049)	109049..109264	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
PIC52_RS23270 (109400)	109400..110047	-	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
PIC52_RS23275 (110239)	110239..110622	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC52_RS23280 (110962)	110962..111564	+	603	WP_077248356.1	transglycosylase SLT domain-containing protein	-
PIC52_RS23285 (111859)	111859..112680	-	822	WP_001234475.1	DUF932 domain-containing protein	-
PIC52_RS23290 (112799)	112799..113086	-	288	WP_000107546.1	hypothetical protein	-
PIC52_RS23295 (113111)	113111..113317	-	207	WP_000547965.1	hypothetical protein	-
PIC52_RS23300 (113387)	113387..113683	+	297	Protein_119	hypothetical protein	-
PIC52_RS23305 (113984)	113984..114109	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC52_RS23310 (114051)	114051..114200	-	150	Protein_121	DUF5431 family protein	-
- (114207)	114207..114405	-	199	NuclAT_0	-	Antitoxin
- (114207)	114207..114405	-	199	NuclAT_0	-	Antitoxin
- (114207)	114207..114405	-	199	NuclAT_0	-	Antitoxin
- (114207)	114207..114405	-	199	NuclAT_0	-	Antitoxin
PIC52_RS23315 (114374)	114374..115136	-	763	Protein_122	plasmid SOS inhibition protein A	-
PIC52_RS23320 (115133)	115133..115567	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
PIC52_RS23325 (115622)	115622..117580	-	1959	WP_029487628.1	ParB/RepB/Spo0J family partition protein	-
PIC52_RS23330 (117646)	117646..117879	-	234	WP_000005990.1	DUF905 family protein	-
PIC52_RS23335 (117936)	117936..118475	-	540	WP_000290801.1	single-stranded DNA-binding protein	-
PIC52_RS23340 (118793)	118793..119302	+	510	WP_071600123.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / qnrS1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD	iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA	1..178682	178682

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T267950 WP_096937776.1 NZ_CP116101:c114109-113984 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT267950 NZ_CP116101:c114405-114207 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin