Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 113984..114405 | Replicon | plasmid pDETEC23 |
| Accession | NZ_CP116101 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIC52_RS23305 | Protein ID | WP_096937776.1 |
| Coordinates | 113984..114109 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 114207..114405 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS23265 (109049) | 109049..109264 | - | 216 | WP_001352842.1 | conjugal transfer relaxosome protein TraY | - |
| PIC52_RS23270 (109400) | 109400..110047 | - | 648 | WP_000332520.1 | conjugal transfer transcriptional regulator TraJ | - |
| PIC52_RS23275 (110239) | 110239..110622 | - | 384 | WP_001063020.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIC52_RS23280 (110962) | 110962..111564 | + | 603 | WP_077248356.1 | transglycosylase SLT domain-containing protein | - |
| PIC52_RS23285 (111859) | 111859..112680 | - | 822 | WP_001234475.1 | DUF932 domain-containing protein | - |
| PIC52_RS23290 (112799) | 112799..113086 | - | 288 | WP_000107546.1 | hypothetical protein | - |
| PIC52_RS23295 (113111) | 113111..113317 | - | 207 | WP_000547965.1 | hypothetical protein | - |
| PIC52_RS23300 (113387) | 113387..113683 | + | 297 | Protein_119 | hypothetical protein | - |
| PIC52_RS23305 (113984) | 113984..114109 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIC52_RS23310 (114051) | 114051..114200 | - | 150 | Protein_121 | DUF5431 family protein | - |
| - (114207) | 114207..114405 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (114207) | 114207..114405 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (114207) | 114207..114405 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (114207) | 114207..114405 | - | 199 | NuclAT_0 | - | Antitoxin |
| PIC52_RS23315 (114374) | 114374..115136 | - | 763 | Protein_122 | plasmid SOS inhibition protein A | - |
| PIC52_RS23320 (115133) | 115133..115567 | - | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| PIC52_RS23325 (115622) | 115622..117580 | - | 1959 | WP_029487628.1 | ParB/RepB/Spo0J family partition protein | - |
| PIC52_RS23330 (117646) | 117646..117879 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| PIC52_RS23335 (117936) | 117936..118475 | - | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
| PIC52_RS23340 (118793) | 118793..119302 | + | 510 | WP_071600123.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / qnrS1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..178682 | 178682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T267950 WP_096937776.1 NZ_CP116101:c114109-113984 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT267950 NZ_CP116101:c114405-114207 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|