Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3664895..3665622 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | PIC52_RS17800 | Protein ID | WP_000550189.1 |
Coordinates | 3664895..3665209 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC52_RS17805 | Protein ID | WP_000560266.1 |
Coordinates | 3665206..3665622 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS17780 (3661052) | 3661052..3662038 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
PIC52_RS17785 (3662117) | 3662117..3662809 | - | 693 | WP_000946651.1 | vancomycin high temperature exclusion protein | - |
PIC52_RS17790 (3662886) | 3662886..3663389 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
PIC52_RS17795 (3663474) | 3663474..3664610 | + | 1137 | WP_001606198.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
PIC52_RS17800 (3664895) | 3664895..3665209 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
PIC52_RS17805 (3665206) | 3665206..3665622 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
PIC52_RS17810 (3665667) | 3665667..3667685 | - | 2019 | WP_001606197.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
PIC52_RS17815 (3667911) | 3667911..3670262 | - | 2352 | WP_001606195.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T267947 WP_000550189.1 NZ_CP116100:3664895-3665209 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT267947 WP_000560266.1 NZ_CP116100:3665206-3665622 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|