Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3622935..3623734 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | PIC52_RS17575 | Protein ID | WP_000347251.1 |
Coordinates | 3622935..3623399 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | PIC52_RS17580 | Protein ID | WP_001296435.1 |
Coordinates | 3623399..3623734 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS17545 (3617936) | 3617936..3618370 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PIC52_RS17550 (3618388) | 3618388..3619266 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIC52_RS17555 (3619256) | 3619256..3620035 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIC52_RS17560 (3620046) | 3620046..3620519 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIC52_RS17565 (3620542) | 3620542..3621822 | - | 1281 | WP_001606210.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIC52_RS17570 (3622071) | 3622071..3622880 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PIC52_RS17575 (3622935) | 3622935..3623399 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIC52_RS17580 (3623399) | 3623399..3623734 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIC52_RS17585 (3623883) | 3623883..3625454 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
PIC52_RS17590 (3625829) | 3625829..3627163 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIC52_RS17595 (3627179) | 3627179..3627949 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T267946 WP_000347251.1 NZ_CP116100:c3623399-3622935 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |