267943

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) HipBST/HipA(toxin)
Location 3202613..3203931 Replicon chromosome
Accession NZ_CP116100
Organism Escherichia coli strain DETEC-P881

Toxin (Protein)


Gene name HipT Uniprot ID F4T5A3
Locus tag PIC52_RS15455 Protein ID WP_001262467.1
Coordinates 3202924..3203931 (+) Length 336 a.a.

Antitoxin (Protein)


Gene name HipS Uniprot ID F4T5A4
Locus tag PIC52_RS15450 Protein ID WP_001312177.1
Coordinates 3202613..3202924 (+) Length 104 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC52_RS15425 (3198145) 3198145..3199164 + 1020 WP_000938855.1 dipeptide ABC transporter permease DppB -
PIC52_RS15430 (3199174) 3199174..3200076 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
PIC52_RS15435 (3200087) 3200087..3201070 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
PIC52_RS15440 (3201067) 3201067..3202080 + 1014 WP_000103555.1 dipeptide ABC transporter ATP-binding subunit DppF -
PIC52_RS15445 (3202305) 3202305..3202628 + 324 WP_000563102.1 helix-turn-helix transcriptional regulator -
PIC52_RS15450 (3202613) 3202613..3202924 + 312 WP_001312177.1 HipA N-terminal domain-containing protein Antitoxin
PIC52_RS15455 (3202924) 3202924..3203931 + 1008 WP_001262467.1 HipA domain-containing protein Toxin
PIC52_RS15460 (3203948) 3203948..3205219 - 1272 WP_001312176.1 amino acid permease -
- (3205581) 3205581..3205646 - 66 NuclAT_19 - -
- (3205581) 3205581..3205646 - 66 NuclAT_19 - -
- (3205581) 3205581..3205646 - 66 NuclAT_19 - -
- (3205581) 3205581..3205646 - 66 NuclAT_19 - -
- (3205581) 3205581..3205646 - 66 NuclAT_21 - -
- (3205581) 3205581..3205646 - 66 NuclAT_21 - -
- (3205581) 3205581..3205646 - 66 NuclAT_21 - -
- (3205581) 3205581..3205646 - 66 NuclAT_21 - -
- (3205583) 3205583..3205646 - 64 NuclAT_23 - -
- (3205583) 3205583..3205646 - 64 NuclAT_23 - -
- (3205583) 3205583..3205646 - 64 NuclAT_23 - -
- (3205583) 3205583..3205646 - 64 NuclAT_23 - -
- (3205583) 3205583..3205646 - 64 NuclAT_25 - -
- (3205583) 3205583..3205646 - 64 NuclAT_25 - -
- (3205583) 3205583..3205646 - 64 NuclAT_25 - -
- (3205583) 3205583..3205646 - 64 NuclAT_25 - -
- (3205583) 3205583..3205646 - 64 NuclAT_27 - -
- (3205583) 3205583..3205646 - 64 NuclAT_27 - -
- (3205583) 3205583..3205646 - 64 NuclAT_27 - -
- (3205583) 3205583..3205646 - 64 NuclAT_27 - -
- (3205583) 3205583..3205646 - 64 NuclAT_29 - -
- (3205583) 3205583..3205646 - 64 NuclAT_29 - -
- (3205583) 3205583..3205646 - 64 NuclAT_29 - -
- (3205583) 3205583..3205646 - 64 NuclAT_29 - -
PIC52_RS15465 (3205695) 3205695..3205802 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3206064) 3206064..3206121 - 58 NuclAT_18 - -
- (3206064) 3206064..3206121 - 58 NuclAT_18 - -
- (3206064) 3206064..3206121 - 58 NuclAT_18 - -
- (3206064) 3206064..3206121 - 58 NuclAT_18 - -
- (3206064) 3206064..3206121 - 58 NuclAT_20 - -
- (3206064) 3206064..3206121 - 58 NuclAT_20 - -
- (3206064) 3206064..3206121 - 58 NuclAT_20 - -
- (3206064) 3206064..3206121 - 58 NuclAT_20 - -
- (3206066) 3206066..3206121 - 56 NuclAT_22 - -
- (3206066) 3206066..3206121 - 56 NuclAT_22 - -
- (3206066) 3206066..3206121 - 56 NuclAT_22 - -
- (3206066) 3206066..3206121 - 56 NuclAT_22 - -
- (3206066) 3206066..3206121 - 56 NuclAT_24 - -
- (3206066) 3206066..3206121 - 56 NuclAT_24 - -
- (3206066) 3206066..3206121 - 56 NuclAT_24 - -
- (3206066) 3206066..3206121 - 56 NuclAT_24 - -
- (3206066) 3206066..3206121 - 56 NuclAT_26 - -
- (3206066) 3206066..3206121 - 56 NuclAT_26 - -
- (3206066) 3206066..3206121 - 56 NuclAT_26 - -
- (3206066) 3206066..3206121 - 56 NuclAT_26 - -
- (3206066) 3206066..3206121 - 56 NuclAT_28 - -
- (3206066) 3206066..3206121 - 56 NuclAT_28 - -
- (3206066) 3206066..3206121 - 56 NuclAT_28 - -
- (3206066) 3206066..3206121 - 56 NuclAT_28 - -
PIC52_RS15470 (3206178) 3206178..3206285 + 108 WP_000170748.1 type I toxin-antitoxin system toxin Ldr family protein -
PIC52_RS15475 (3206661) 3206661..3206768 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
PIC52_RS15480 (3206854) 3206854..3208533 - 1680 Protein_3018 cellulose biosynthesis protein BcsG -
PIC52_RS15485 (3208530) 3208530..3208721 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HipA-like, C-terminal

(56-302)

Antitoxin

HipA, N-terminal subdomain 1

(6-98)


Sequences

Toxin        


Download         Length: 336 a.a.        Molecular weight: 38320.60 Da        Isoelectric Point: 5.5965

>T267943 WP_001262467.1 NZ_CP116100:3202924-3203931 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL

Download         Length: 1008 bp

Antitoxin


Download         Length: 104 a.a.        Molecular weight: 11821.47 Da        Isoelectric Point: 6.0609

>AT267943 WP_001312177.1 NZ_CP116100:3202613-3202924 [Escherichia coli]
MHRRVKVLLYGQVVGELSQNDSGFLFQYAPDYHGPAISISLPVAQRQFPSEMLHPYFASLAPEGWLRQRYSQIQHRDEND
LLGMLIDNGKNLLGAIQILPWEE

Download         Length: 312 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3K2ZTB5

Antitoxin

Source ID Structure
AlphaFold DB A0A3L3HKE2

References