Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
| Location | 3202613..3203931 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | HipT | Uniprot ID | F4T5A3 |
| Locus tag | PIC52_RS15455 | Protein ID | WP_001262467.1 |
| Coordinates | 3202924..3203931 (+) | Length | 336 a.a. |
Antitoxin (Protein)
| Gene name | HipS | Uniprot ID | F4T5A4 |
| Locus tag | PIC52_RS15450 | Protein ID | WP_001312177.1 |
| Coordinates | 3202613..3202924 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS15425 (3198145) | 3198145..3199164 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
| PIC52_RS15430 (3199174) | 3199174..3200076 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| PIC52_RS15435 (3200087) | 3200087..3201070 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| PIC52_RS15440 (3201067) | 3201067..3202080 | + | 1014 | WP_000103555.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| PIC52_RS15445 (3202305) | 3202305..3202628 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
| PIC52_RS15450 (3202613) | 3202613..3202924 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
| PIC52_RS15455 (3202924) | 3202924..3203931 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
| PIC52_RS15460 (3203948) | 3203948..3205219 | - | 1272 | WP_001312176.1 | amino acid permease | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_19 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_19 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_19 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_19 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_21 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_21 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_21 | - | - |
| - (3205581) | 3205581..3205646 | - | 66 | NuclAT_21 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_23 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_23 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_23 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_23 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_25 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_25 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_25 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_25 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_27 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_27 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_27 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_27 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_29 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_29 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_29 | - | - |
| - (3205583) | 3205583..3205646 | - | 64 | NuclAT_29 | - | - |
| PIC52_RS15465 (3205695) | 3205695..3205802 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_18 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_18 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_18 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_18 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_20 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_20 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_20 | - | - |
| - (3206064) | 3206064..3206121 | - | 58 | NuclAT_20 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_22 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_22 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_22 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_22 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_24 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_24 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_24 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_24 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_26 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_26 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_26 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_26 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_28 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_28 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_28 | - | - |
| - (3206066) | 3206066..3206121 | - | 56 | NuclAT_28 | - | - |
| PIC52_RS15470 (3206178) | 3206178..3206285 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PIC52_RS15475 (3206661) | 3206661..3206768 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PIC52_RS15480 (3206854) | 3206854..3208533 | - | 1680 | Protein_3018 | cellulose biosynthesis protein BcsG | - |
| PIC52_RS15485 (3208530) | 3208530..3208721 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T267943 WP_001262467.1 NZ_CP116100:3202924-3203931 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L3HKE2 |