Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2802733..2803335 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PIC52_RS13550 | Protein ID | WP_024193748.1 |
Coordinates | 2803024..2803335 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC52_RS13545 | Protein ID | WP_000356397.1 |
Coordinates | 2802733..2803023 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS13515 (2797890) | 2797890..2798819 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PIC52_RS13520 (2799149) | 2799149..2799391 | - | 243 | WP_001523574.1 | CopG family transcriptional regulator | - |
PIC52_RS13525 (2799681) | 2799681..2800529 | + | 849 | WP_001038651.1 | hypothetical protein | - |
PIC52_RS13530 (2800554) | 2800554..2801294 | + | 741 | WP_000608806.1 | hypothetical protein | - |
PIC52_RS13535 (2801479) | 2801479..2801697 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
PIC52_RS13540 (2802096) | 2802096..2802374 | - | 279 | WP_001296612.1 | hypothetical protein | - |
PIC52_RS13545 (2802733) | 2802733..2803023 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIC52_RS13550 (2803024) | 2803024..2803335 | - | 312 | WP_024193748.1 | hypothetical protein | Toxin |
PIC52_RS13555 (2803564) | 2803564..2804472 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
PIC52_RS13560 (2804536) | 2804536..2805477 | - | 942 | WP_001606560.1 | fatty acid biosynthesis protein FabY | - |
PIC52_RS13565 (2805522) | 2805522..2805959 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PIC52_RS13570 (2805956) | 2805956..2806828 | - | 873 | WP_000920763.1 | virulence factor BrkB family protein | - |
PIC52_RS13575 (2806822) | 2806822..2807421 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
PIC52_RS13580 (2807520) | 2807520..2808305 | - | 786 | WP_001606559.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12302.33 Da Isoelectric Point: 10.0233
>T267941 WP_024193748.1 NZ_CP116100:c2803335-2803024 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRIRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRIRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|