Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1868629..1869323 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PIC52_RS09225 | Protein ID | WP_001263500.1 |
Coordinates | 1868629..1869027 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC52_RS09230 | Protein ID | WP_000554758.1 |
Coordinates | 1869030..1869323 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS09200 (1863995) | 1863995..1864453 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
PIC52_RS09205 (1864714) | 1864714..1866171 | + | 1458 | WP_001293022.1 | cytosol nonspecific dipeptidase | - |
PIC52_RS09210 (1866227) | 1866227..1866841 | - | 615 | WP_001606887.1 | peptide chain release factor H | - |
PIC52_RS09215 (1866838) | 1866838..1867977 | - | 1140 | WP_001606885.1 | RNA ligase RtcB family protein | - |
PIC52_RS09220 (1868167) | 1868167..1868619 | - | 453 | WP_071589393.1 | GNAT family N-acetyltransferase | - |
PIC52_RS09225 (1868629) | 1868629..1869027 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC52_RS09230 (1869030) | 1869030..1869323 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC52_RS09235 (1869375) | 1869375..1870430 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
PIC52_RS09240 (1870501) | 1870501..1871286 | - | 786 | WP_000207551.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC52_RS09245 (1871258) | 1871258..1872970 | + | 1713 | Protein_1815 | flagellar biosynthesis protein FlhA | - |
PIC52_RS09250 (1873086) | 1873086..1873583 | - | 498 | WP_001606851.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T267937 WP_001263500.1 NZ_CP116100:c1869027-1868629 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|