Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1650049..1650728 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | PIC52_RS08220 | Protein ID | WP_000057523.1 |
| Coordinates | 1650426..1650728 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | PIC52_RS08215 | Protein ID | WP_000806442.1 |
| Coordinates | 1650049..1650390 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS08205 (1646293) | 1646293..1647225 | - | 933 | WP_000883041.1 | glutaminase A | - |
| PIC52_RS08210 (1647487) | 1647487..1649991 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| PIC52_RS08215 (1650049) | 1650049..1650390 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| PIC52_RS08220 (1650426) | 1650426..1650728 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PIC52_RS08225 (1650861) | 1650861..1651655 | + | 795 | WP_001526714.1 | TraB/GumN family protein | - |
| PIC52_RS08230 (1651859) | 1651859..1652338 | + | 480 | WP_000186631.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| PIC52_RS08235 (1652375) | 1652375..1654027 | - | 1653 | WP_271287364.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| PIC52_RS08240 (1654245) | 1654245..1655465 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T267935 WP_000057523.1 NZ_CP116100:c1650728-1650426 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|