Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40771..41035 Replicon plasmid pDETEC69
Accession NZ_CP116096
Organism Escherichia coli strain DETEC-S560

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag PIC78_RS24820 Protein ID WP_001387489.1
Coordinates 40883..41035 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40771..40831 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC78_RS24805 (36873) 36873..37943 - 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -
PIC78_RS24810 (37962) 37962..39170 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
- (39350) 39350..39407 - 58 NuclAT_1 - -
- (39350) 39350..39407 - 58 NuclAT_1 - -
- (39350) 39350..39407 - 58 NuclAT_1 - -
- (39350) 39350..39407 - 58 NuclAT_1 - -
PIC78_RS24815 (39477) 39477..40562 - 1086 WP_000080543.1 protein finQ -
- (40771) 40771..40831 - 61 NuclAT_0 - Antitoxin
- (40771) 40771..40831 - 61 NuclAT_0 - Antitoxin
- (40771) 40771..40831 - 61 NuclAT_0 - Antitoxin
- (40771) 40771..40831 - 61 NuclAT_0 - Antitoxin
PIC78_RS24820 (40883) 40883..41035 + 153 WP_001387489.1 Hok/Gef family protein Toxin
PIC78_RS24825 (41107) 41107..41358 - 252 WP_271287794.1 hypothetical protein -
PIC78_RS24830 (41859) 41859..41954 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PIC78_RS24835 (42019) 42019..42195 - 177 WP_001054900.1 hypothetical protein -
PIC78_RS24840 (42587) 42587..42796 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PIC78_RS24845 (42868) 42868..43530 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
PIC78_RS24850 (43601) 43601..45769 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..86167 86167


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T267923 WP_001387489.1 NZ_CP116096:40883-41035 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT267923 NZ_CP116096:c40831-40771 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References