Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40771..41035 | Replicon | plasmid pDETEC69 |
| Accession | NZ_CP116096 | ||
| Organism | Escherichia coli strain DETEC-S560 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | PIC78_RS24820 | Protein ID | WP_001387489.1 |
| Coordinates | 40883..41035 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 40771..40831 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC78_RS24805 (36873) | 36873..37943 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
| PIC78_RS24810 (37962) | 37962..39170 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (39350) | 39350..39407 | - | 58 | NuclAT_1 | - | - |
| - (39350) | 39350..39407 | - | 58 | NuclAT_1 | - | - |
| - (39350) | 39350..39407 | - | 58 | NuclAT_1 | - | - |
| - (39350) | 39350..39407 | - | 58 | NuclAT_1 | - | - |
| PIC78_RS24815 (39477) | 39477..40562 | - | 1086 | WP_000080543.1 | protein finQ | - |
| - (40771) | 40771..40831 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40771) | 40771..40831 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40771) | 40771..40831 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40771) | 40771..40831 | - | 61 | NuclAT_0 | - | Antitoxin |
| PIC78_RS24820 (40883) | 40883..41035 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| PIC78_RS24825 (41107) | 41107..41358 | - | 252 | WP_271287794.1 | hypothetical protein | - |
| PIC78_RS24830 (41859) | 41859..41954 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PIC78_RS24835 (42019) | 42019..42195 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| PIC78_RS24840 (42587) | 42587..42796 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PIC78_RS24845 (42868) | 42868..43530 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PIC78_RS24850 (43601) | 43601..45769 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 | - | 1..86167 | 86167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T267923 WP_001387489.1 NZ_CP116096:40883-41035 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT267923 NZ_CP116096:c40831-40771 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|