Detailed information of TA system TA267920

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 79060..79486
• Replicon: plasmid pDETEC68
• Accession: NZ_CP116095
• Organism: Escherichia coli strain DETEC-S560

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC78_RS24445
• Protein ID: WP_001372321.1
• Coordinates: 79060..79185 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	79262..79486 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC78_RS24405 (74434)	74434..75123	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIC78_RS24410 (75310)	75310..75693	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC78_RS24415 (76014)	76014..76616	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PIC78_RS24420 (76913)	76913..77734	-	822	WP_001234426.1	DUF932 domain-containing protein	-
PIC78_RS24425 (77852)	77852..78139	-	288	WP_000107535.1	hypothetical protein	-
PIC78_RS24430 (78164)	78164..78370	-	207	WP_000547968.1	hypothetical protein	-
PIC78_RS24435 (78440)	78440..78612	+	173	Protein_100	hypothetical protein	-
PIC78_RS24440 (78610)	78610..78840	-	231	WP_071586998.1	hypothetical protein	-
PIC78_RS24445 (79060)	79060..79185	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC78_RS24450 (79127)	79127..79276	-	150	Protein_103	plasmid maintenance protein Mok	-
- (79262)	79262..79486	-	225	NuclAT_0	-	Antitoxin
- (79262)	79262..79486	-	225	NuclAT_0	-	Antitoxin
- (79262)	79262..79486	-	225	NuclAT_0	-	Antitoxin
- (79262)	79262..79486	-	225	NuclAT_0	-	Antitoxin
PIC78_RS24455 (79298)	79298..79486	+	189	WP_001299721.1	hypothetical protein	-
PIC78_RS24460 (79455)	79455..80217	-	763	Protein_105	plasmid SOS inhibition protein A	-
PIC78_RS24465 (80214)	80214..80648	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PIC78_RS24470 (80703)	80703..80900	-	198	Protein_107	hypothetical protein	-
PIC78_RS24475 (80928)	80928..81161	-	234	WP_000005987.1	DUF905 family protein	-
PIC78_RS24480 (81229)	81229..81768	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
PIC78_RS24485 (81794)	81794..82000	-	207	WP_000275856.1	hypothetical protein	-
PIC78_RS24490 (82070)	82070..82150	+	81	Protein_111	hypothetical protein	-
PIC78_RS24495 (82333)	82333..82502	-	170	Protein_112	hypothetical protein	-
PIC78_RS24500 (83096)	83096..84067	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iutA / iucD / iucC / iucB / iucA	1..102896	102896

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267920 WP_001372321.1 NZ_CP116095:c79185-79060 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT267920 NZ_CP116095:c79486-79262 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin