Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40731..40985 | Replicon | plasmid pDETEC68 |
| Accession | NZ_CP116095 | ||
| Organism | Escherichia coli strain DETEC-S560 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC78_RS24210 | Protein ID | WP_001312851.1 |
| Coordinates | 40731..40880 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 40924..40985 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC78_RS24165 (36294) | 36294..36695 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PIC78_RS24170 (36628) | 36628..36885 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PIC78_RS24175 (36978) | 36978..37286 | - | 309 | WP_226116723.1 | CPBP family intramembrane metalloprotease | - |
| PIC78_RS24180 (37228) | 37228..37620 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| PIC78_RS24185 (38559) | 38559..39416 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PIC78_RS24190 (39409) | 39409..39891 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC78_RS24195 (39884) | 39884..39931 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC78_RS24200 (39922) | 39922..40173 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC78_RS24205 (40190) | 40190..40447 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC78_RS24210 (40731) | 40731..40880 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (40924) | 40924..40985 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (40924) | 40924..40985 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (40924) | 40924..40985 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (40924) | 40924..40985 | + | 62 | NuclAT_1 | - | Antitoxin |
| PIC78_RS24215 (41241) | 41241..41315 | - | 75 | Protein_56 | endonuclease | - |
| PIC78_RS24220 (41561) | 41561..41773 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC78_RS24225 (41909) | 41909..42469 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC78_RS24230 (42572) | 42572..43432 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| PIC78_RS24235 (43491) | 43491..44237 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..102896 | 102896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T267915 WP_001312851.1 NZ_CP116095:c40880-40731 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT267915 NZ_CP116095:40924-40985 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
