Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3992337..3993030 | Replicon | chromosome |
| Accession | NZ_CP116094 | ||
| Organism | Escherichia coli strain DETEC-S560 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | PIC78_RS19290 | Protein ID | WP_000415584.1 |
| Coordinates | 3992734..3993030 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PIC78_RS19285 | Protein ID | WP_000650107.1 |
| Coordinates | 3992337..3992732 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC78_RS19270 (3989273) | 3989273..3990274 | - | 1002 | Protein_3761 | ABC transporter substrate-binding protein | - |
| PIC78_RS19275 (3990336) | 3990336..3991556 | + | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| PIC78_RS19280 (3991485) | 3991485..3992204 | - | 720 | Protein_3763 | ABC transporter substrate-binding protein | - |
| PIC78_RS19285 (3992337) | 3992337..3992732 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PIC78_RS19290 (3992734) | 3992734..3993030 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PIC78_RS19295 (3993235) | 3993235..3993717 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PIC78_RS19300 (3993770) | 3993770..3994162 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PIC78_RS19305 (3994314) | 3994314..3994973 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| PIC78_RS19310 (3994970) | 3994970..3996319 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| PIC78_RS19315 (3996365) | 3996365..3996697 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
| PIC78_RS19320 (3997016) | 3997016..3997597 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| PIC78_RS19325 (3997628) | 3997628..3997942 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3990336..3991556 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T267912 WP_000415584.1 NZ_CP116094:c3993030-3992734 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT267912 WP_000650107.1 NZ_CP116094:c3992732-3992337 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|