Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2205013..2205651 | Replicon | chromosome |
Accession | NZ_CP116094 | ||
Organism | Escherichia coli strain DETEC-S560 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | PIC78_RS10840 | Protein ID | WP_001447010.1 |
Coordinates | 2205013..2205189 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PIC78_RS10845 | Protein ID | WP_001270286.1 |
Coordinates | 2205235..2205651 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC78_RS10820 (2200632) | 2200632..2201807 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
PIC78_RS10825 (2201899) | 2201899..2202435 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PIC78_RS10830 (2202508) | 2202508..2204469 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PIC78_RS10835 (2204561) | 2204561..2204791 | - | 231 | WP_000494244.1 | YncJ family protein | - |
PIC78_RS10840 (2205013) | 2205013..2205189 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PIC78_RS10845 (2205235) | 2205235..2205651 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PIC78_RS10850 (2205730) | 2205730..2207136 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
PIC78_RS10855 (2207381) | 2207381..2208526 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
PIC78_RS10860 (2208544) | 2208544..2209557 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
PIC78_RS10865 (2209558) | 2209558..2210499 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2199444..2200592 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T267901 WP_001447010.1 NZ_CP116094:2205013-2205189 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT267901 WP_001270286.1 NZ_CP116094:2205235-2205651 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|