Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 848478..849172 | Replicon | chromosome |
| Accession | NZ_CP116094 | ||
| Organism | Escherichia coli strain DETEC-S560 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | PIC78_RS04065 | Protein ID | WP_001263489.1 |
| Coordinates | 848774..849172 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PIC78_RS04060 | Protein ID | WP_000554758.1 |
| Coordinates | 848478..848771 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC78_RS04040 (844110) | 844110..844607 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| PIC78_RS04045 (844831) | 844831..846543 | - | 1713 | Protein_781 | flagellar biosynthesis protein FlhA | - |
| PIC78_RS04050 (846515) | 846515..847300 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| PIC78_RS04055 (847371) | 847371..848426 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| PIC78_RS04060 (848478) | 848478..848771 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PIC78_RS04065 (848774) | 848774..849172 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PIC78_RS04070 (849182) | 849182..849634 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| PIC78_RS04075 (849952) | 849952..850158 | + | 207 | Protein_787 | RtcB family protein | - |
| PIC78_RS04080 (850154) | 850154..850675 | + | 522 | Protein_788 | peptide chain release factor H | - |
| PIC78_RS04085 (850732) | 850732..852189 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| PIC78_RS04090 (852450) | 852450..852908 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (853504) | 853504..853584 | + | 81 | NuclAT_11 | - | - |
| - (853504) | 853504..853584 | + | 81 | NuclAT_11 | - | - |
| - (853504) | 853504..853584 | + | 81 | NuclAT_11 | - | - |
| - (853504) | 853504..853584 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 833649..867460 | 33811 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T267899 WP_001263489.1 NZ_CP116094:848774-849172 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |