Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 45041..45305 Replicon plasmid pDETEC73
Accession NZ_CP116090
Organism Escherichia coli strain DETEC-S565

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag PIC22_RS24680 Protein ID WP_001387489.1
Coordinates 45153..45305 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 45041..45101 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC22_RS24665 (41143) 41143..42213 - 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -
PIC22_RS24670 (42232) 42232..43440 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
- (43620) 43620..43677 - 58 NuclAT_1 - -
- (43620) 43620..43677 - 58 NuclAT_1 - -
- (43620) 43620..43677 - 58 NuclAT_1 - -
- (43620) 43620..43677 - 58 NuclAT_1 - -
PIC22_RS24675 (43747) 43747..44832 - 1086 WP_000080543.1 protein finQ -
- (45041) 45041..45101 - 61 NuclAT_0 - Antitoxin
- (45041) 45041..45101 - 61 NuclAT_0 - Antitoxin
- (45041) 45041..45101 - 61 NuclAT_0 - Antitoxin
- (45041) 45041..45101 - 61 NuclAT_0 - Antitoxin
PIC22_RS24680 (45153) 45153..45305 + 153 WP_001387489.1 Hok/Gef family protein Toxin
PIC22_RS24685 (45377) 45377..45628 - 252 WP_001291964.1 hypothetical protein -
PIC22_RS24690 (46129) 46129..46224 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PIC22_RS24695 (46289) 46289..46465 - 177 WP_001054900.1 hypothetical protein -
PIC22_RS24700 (46857) 46857..47066 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PIC22_RS24705 (47138) 47138..47800 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
PIC22_RS24710 (47871) 47871..50039 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..90981 90981


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T267890 WP_001387489.1 NZ_CP116090:45153-45305 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT267890 NZ_CP116090:c45101-45041 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References