Detailed information of TA system TA267887

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 171954..172375
• Replicon: plasmid pDETEC72
• Accession: NZ_CP116089
• Organism: Escherichia coli strain DETEC-S565

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC22_RS24300
• Protein ID: WP_096937776.1
• Coordinates: 171954..172079 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	172177..172375 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC22_RS24265 (167021)	167021..167236	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
PIC22_RS24270 (167372)	167372..168019	-	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
PIC22_RS24275 (168211)	168211..168594	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC22_RS24280 (168946)	168946..169536	+	591	WP_166494936.1	transglycosylase SLT domain-containing protein	-
PIC22_RS24285 (169831)	169831..170652	-	822	WP_001234475.1	DUF932 domain-containing protein	-
PIC22_RS24290 (170771)	170771..171058	-	288	WP_000107546.1	hypothetical protein	-
PIC22_RS24295 (171375)	171375..171653	+	279	Protein_174	hypothetical protein	-
PIC22_RS24300 (171954)	171954..172079	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC22_RS24305 (172021)	172021..172170	-	150	Protein_176	DUF5431 family protein	-
- (172177)	172177..172375	-	199	NuclAT_0	-	Antitoxin
- (172177)	172177..172375	-	199	NuclAT_0	-	Antitoxin
- (172177)	172177..172375	-	199	NuclAT_0	-	Antitoxin
- (172177)	172177..172375	-	199	NuclAT_0	-	Antitoxin
PIC22_RS24310 (172344)	172344..173106	-	763	Protein_177	plasmid SOS inhibition protein A	-
PIC22_RS24315 (173103)	173103..173537	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
PIC22_RS24320 (173592)	173592..175550	-	1959	WP_029487628.1	ParB/RepB/Spo0J family partition protein	-
PIC22_RS24325 (175616)	175616..175849	-	234	WP_000005990.1	DUF905 family protein	-
PIC22_RS24330 (175906)	175906..176445	-	540	WP_000290801.1	single-stranded DNA-binding protein	-
PIC22_RS24335 (176763)	176763..177272	+	510	WP_071600123.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / tet(A) / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B	iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat	1..187674	187674

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T267887 WP_096937776.1 NZ_CP116089:c172079-171954 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT267887 NZ_CP116089:c172375-172177 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin