Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 133802..134056 | Replicon | plasmid pDETEC72 |
| Accession | NZ_CP116089 | ||
| Organism | Escherichia coli strain DETEC-S565 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC22_RS24075 | Protein ID | WP_001312851.1 |
| Coordinates | 133802..133951 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 133995..134056 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC22_RS24045 (129084) | 129084..132089 | + | 3006 | WP_001143760.1 | Tn3-like element Tn3 family transposase | - |
| PIC22_RS24050 (132022) | 132022..132487 | - | 466 | Protein_125 | plasmid replication initiator RepA | - |
| PIC22_RS24055 (132480) | 132480..132962 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC22_RS24060 (132955) | 132955..133002 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC22_RS24065 (132993) | 132993..133244 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC22_RS24070 (133261) | 133261..133518 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC22_RS24075 (133802) | 133802..133951 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (133995) | 133995..134056 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (133995) | 133995..134056 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (133995) | 133995..134056 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (133995) | 133995..134056 | + | 62 | NuclAT_1 | - | Antitoxin |
| PIC22_RS24080 (134312) | 134312..134386 | - | 75 | Protein_131 | endonuclease | - |
| PIC22_RS24085 (134632) | 134632..134844 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC22_RS24090 (134980) | 134980..135540 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC22_RS24095 (135643) | 135643..136503 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| PIC22_RS24100 (136562) | 136562..137308 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..187674 | 187674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T267885 WP_001312851.1 NZ_CP116089:c133951-133802 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT267885 NZ_CP116089:133995-134056 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|