Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 133802..134056 Replicon plasmid pDETEC72
Accession NZ_CP116089
Organism Escherichia coli strain DETEC-S565

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PIC22_RS24075 Protein ID WP_001312851.1
Coordinates 133802..133951 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 133995..134056 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC22_RS24045 (129084) 129084..132089 + 3006 WP_001143760.1 Tn3-like element Tn3 family transposase -
PIC22_RS24050 (132022) 132022..132487 - 466 Protein_125 plasmid replication initiator RepA -
PIC22_RS24055 (132480) 132480..132962 - 483 WP_001273588.1 hypothetical protein -
PIC22_RS24060 (132955) 132955..133002 - 48 WP_229471593.1 hypothetical protein -
PIC22_RS24065 (132993) 132993..133244 + 252 WP_223195197.1 replication protein RepA -
PIC22_RS24070 (133261) 133261..133518 - 258 WP_000083845.1 replication regulatory protein RepA -
PIC22_RS24075 (133802) 133802..133951 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (133995) 133995..134056 + 62 NuclAT_1 - Antitoxin
- (133995) 133995..134056 + 62 NuclAT_1 - Antitoxin
- (133995) 133995..134056 + 62 NuclAT_1 - Antitoxin
- (133995) 133995..134056 + 62 NuclAT_1 - Antitoxin
PIC22_RS24080 (134312) 134312..134386 - 75 Protein_131 endonuclease -
PIC22_RS24085 (134632) 134632..134844 - 213 WP_001299730.1 ANR family transcriptional regulator -
PIC22_RS24090 (134980) 134980..135540 - 561 WP_000139315.1 fertility inhibition protein FinO -
PIC22_RS24095 (135643) 135643..136503 - 861 WP_000704513.1 alpha/beta hydrolase -
PIC22_RS24100 (136562) 136562..137308 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(A) / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..187674 187674


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T267885 WP_001312851.1 NZ_CP116089:c133951-133802 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT267885 NZ_CP116089:133995-134056 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References