Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3351232..3351834 | Replicon | chromosome |
Accession | NZ_CP116088 | ||
Organism | Escherichia coli strain DETEC-S565 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PIC22_RS16520 | Protein ID | WP_000897305.1 |
Coordinates | 3351232..3351543 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC22_RS16525 | Protein ID | WP_000356397.1 |
Coordinates | 3351544..3351834 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC22_RS16490 (3346262) | 3346262..3347047 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PIC22_RS16495 (3347146) | 3347146..3347745 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
PIC22_RS16500 (3347739) | 3347739..3348611 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIC22_RS16505 (3348608) | 3348608..3349045 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PIC22_RS16510 (3349090) | 3349090..3350031 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PIC22_RS16515 (3350095) | 3350095..3351003 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PIC22_RS16520 (3351232) | 3351232..3351543 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PIC22_RS16525 (3351544) | 3351544..3351834 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIC22_RS16530 (3352420) | 3352420..3352638 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
PIC22_RS16535 (3352857) | 3352857..3353099 | + | 243 | WP_001087409.1 | protein YiiF | - |
PIC22_RS16540 (3353429) | 3353429..3354358 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PIC22_RS16545 (3354355) | 3354355..3354990 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PIC22_RS16550 (3354987) | 3354987..3355889 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T267878 WP_000897305.1 NZ_CP116088:3351232-3351543 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|