Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2550581..2551380 | Replicon | chromosome |
Accession | NZ_CP116088 | ||
Organism | Escherichia coli strain DETEC-S565 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A6H2GMC5 |
Locus tag | PIC22_RS12630 | Protein ID | WP_000347279.1 |
Coordinates | 2550916..2551380 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PIC22_RS12625 | Protein ID | WP_001307405.1 |
Coordinates | 2550581..2550916 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC22_RS12610 (2546366) | 2546366..2547136 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PIC22_RS12615 (2547152) | 2547152..2548486 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIC22_RS12620 (2548861) | 2548861..2550432 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
PIC22_RS12625 (2550581) | 2550581..2550916 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIC22_RS12630 (2550916) | 2550916..2551380 | + | 465 | WP_000347279.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIC22_RS12635 (2551435) | 2551435..2552244 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PIC22_RS12640 (2552493) | 2552493..2553773 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIC22_RS12645 (2553796) | 2553796..2554269 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIC22_RS12650 (2554280) | 2554280..2555059 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIC22_RS12655 (2555049) | 2555049..2555927 | + | 879 | WP_271291552.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIC22_RS12660 (2555945) | 2555945..2556379 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2538646..2551380 | 12734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17869.24 Da Isoelectric Point: 9.4947
>T267876 WP_000347279.1 NZ_CP116088:2550916-2551380 [Escherichia coli]
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2GMC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |