Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 707663..708356 | Replicon | chromosome |
Accession | NZ_CP116085 | ||
Organism | Escherichia coli strain DETEC-S566 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PIC95_RS03490 | Protein ID | WP_000415584.1 |
Coordinates | 707663..707959 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PIC95_RS03495 | Protein ID | WP_000650107.1 |
Coordinates | 707961..708356 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC95_RS03455 (702751) | 702751..703065 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
PIC95_RS03460 (703096) | 703096..703677 | - | 582 | WP_000072421.1 | NADPH:quinone oxidoreductase MdaB | - |
PIC95_RS03465 (703996) | 703996..704328 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
PIC95_RS03470 (704374) | 704374..705723 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PIC95_RS03475 (705720) | 705720..706379 | - | 660 | WP_001221510.1 | quorum sensing response regulator transcription factor QseB | - |
PIC95_RS03480 (706531) | 706531..706923 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PIC95_RS03485 (706976) | 706976..707458 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PIC95_RS03490 (707663) | 707663..707959 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PIC95_RS03495 (707961) | 707961..708356 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PIC95_RS03500 (708489) | 708489..710096 | + | 1608 | WP_001735743.1 | ABC transporter substrate-binding protein | - |
PIC95_RS03505 (710234) | 710234..712492 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T267846 WP_000415584.1 NZ_CP116085:707663-707959 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT267846 WP_000650107.1 NZ_CP116085:707961-708356 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|