Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 188426..188648 Replicon chromosome
Accession NZ_CP116085
Organism Escherichia coli strain DETEC-S566

Toxin (Protein)


Gene name ldrD Uniprot ID A0A3K0NFU8
Locus tag PIC95_RS00890 Protein ID WP_000170748.1
Coordinates 188541..188648 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 188426..188484 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC95_RS00860 183430..184443 + 1014 WP_000103572.1 dipeptide ABC transporter ATP-binding subunit DppF -
PIC95_RS00865 184668..184991 + 324 WP_000563102.1 helix-turn-helix transcriptional regulator -
PIC95_RS00870 184976..185287 + 312 WP_001312177.1 HipA N-terminal domain-containing protein -
PIC95_RS00875 185287..186294 + 1008 WP_001262467.1 HipA domain-containing protein -
PIC95_RS00880 186311..187582 - 1272 WP_001545666.1 amino acid permease -
PIC95_RS00885 188058..188165 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 188426..188484 - 59 - - Antitoxin
PIC95_RS00890 188541..188648 + 108 WP_000170748.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
PIC95_RS00895 189024..189131 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
PIC95_RS00900 189217..190896 - 1680 Protein_177 cellulose biosynthesis protein BcsG -
PIC95_RS00905 190893..191084 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
PIC95_RS00910 191081..192652 - 1572 WP_001204941.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
PIC95_RS00915 192925..193113 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3913.76 Da        Isoelectric Point: 9.0157

>T267842 WP_000170748.1 NZ_CP116085:188541-188648 [Escherichia coli]
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT267842 NZ_CP116085:c188484-188426 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3K0NFU8

Antitoxin

Download structure file

References