Detailed information of TA system TA267836

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 28603..28872
• Replicon: plasmid pDETEC48
• Accession: NZ_CP116077
• Organism: Escherichia coli strain DETEC-S586

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC49_RS25260
• Protein ID: WP_001372321.1
• Coordinates: 28747..28872 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	28603..28668 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC49_RS25220	23633..24071	-	439	Protein_36	hypothetical protein	-
PIC49_RS25225	24373..24900	+	528	WP_128469085.1	single-stranded DNA-binding protein	-
PIC49_RS25230	24957..25190	+	234	WP_000006003.1	DUF905 family protein	-
PIC49_RS25235	25251..27215	+	1965	WP_000117316.1	ParB/RepB/Spo0J family partition protein	-
PIC49_RS25240	27284..27718	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIC49_RS25245	27715..28477	+	763	Protein_41	plasmid SOS inhibition protein A	-
-	28446..28670	+	225	NuclAT_0	-	-
-	28446..28670	+	225	NuclAT_0	-	-
-	28446..28670	+	225	NuclAT_0	-	-
-	28446..28670	+	225	NuclAT_0	-	-
PIC49_RS25250	28455..28634	-	180	WP_001309233.1	hypothetical protein	-
-	28603..28668	-	66	-	-	Antitoxin
PIC49_RS25255	28656..28805	+	150	Protein_43	plasmid maintenance protein Mok	-
PIC49_RS25260	28747..28872	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC49_RS25265	29173..29469	-	297	Protein_45	hypothetical protein	-
PIC49_RS25270	29769..30065	+	297	WP_001272251.1	hypothetical protein	-
PIC49_RS25275	30176..30997	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIC49_RS25280	31294..31884	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
PIC49_RS25285	32217..32600	+	384	WP_001151529.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC49_RS25290	32792..33439	+	648	WP_000332523.1	transcriptional regulator TraJ family protein	-
PIC49_RS25295	33559..33786	+	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..70464	70464

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267836 WP_001372321.1 NZ_CP116077:28747-28872 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT267836 NZ_CP116077:c28668-28603 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin