Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28603..28872 | Replicon | plasmid pDETEC48 |
| Accession | NZ_CP116077 | ||
| Organism | Escherichia coli strain DETEC-S586 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIC49_RS25260 | Protein ID | WP_001372321.1 |
| Coordinates | 28747..28872 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 28603..28668 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC49_RS25220 | 23633..24071 | - | 439 | Protein_36 | hypothetical protein | - |
| PIC49_RS25225 | 24373..24900 | + | 528 | WP_128469085.1 | single-stranded DNA-binding protein | - |
| PIC49_RS25230 | 24957..25190 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| PIC49_RS25235 | 25251..27215 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| PIC49_RS25240 | 27284..27718 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| PIC49_RS25245 | 27715..28477 | + | 763 | Protein_41 | plasmid SOS inhibition protein A | - |
| - | 28446..28670 | + | 225 | NuclAT_0 | - | - |
| - | 28446..28670 | + | 225 | NuclAT_0 | - | - |
| - | 28446..28670 | + | 225 | NuclAT_0 | - | - |
| - | 28446..28670 | + | 225 | NuclAT_0 | - | - |
| PIC49_RS25250 | 28455..28634 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 28603..28668 | - | 66 | - | - | Antitoxin |
| PIC49_RS25255 | 28656..28805 | + | 150 | Protein_43 | plasmid maintenance protein Mok | - |
| PIC49_RS25260 | 28747..28872 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIC49_RS25265 | 29173..29469 | - | 297 | Protein_45 | hypothetical protein | - |
| PIC49_RS25270 | 29769..30065 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| PIC49_RS25275 | 30176..30997 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| PIC49_RS25280 | 31294..31884 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| PIC49_RS25285 | 32217..32600 | + | 384 | WP_001151529.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIC49_RS25290 | 32792..33439 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
| PIC49_RS25295 | 33559..33786 | + | 228 | WP_000589556.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..70464 | 70464 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T267836 WP_001372321.1 NZ_CP116077:28747-28872 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT267836 NZ_CP116077:c28668-28603 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|