Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41788..42052 Replicon plasmid pDETEC47
Accession NZ_CP116076
Organism Escherichia coli strain DETEC-S586

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PIC49_RS24800 Protein ID WP_001331364.1
Coordinates 41900..42052 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 41788..41850 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC49_RS24785 (37830) 37830..38900 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
PIC49_RS24790 (38919) 38919..40127 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
PIC49_RS24795 (40345) 40345..41298 - 954 WP_021513958.1 hypothetical protein -
- (41492) 41492..41547 - 56 NuclAT_1 - -
- (41492) 41492..41547 - 56 NuclAT_1 - -
- (41492) 41492..41547 - 56 NuclAT_1 - -
- (41492) 41492..41547 - 56 NuclAT_1 - -
- (41788) 41788..41850 - 63 NuclAT_0 - Antitoxin
- (41788) 41788..41850 - 63 NuclAT_0 - Antitoxin
- (41788) 41788..41850 - 63 NuclAT_0 - Antitoxin
- (41788) 41788..41850 - 63 NuclAT_0 - Antitoxin
PIC49_RS24800 (41900) 41900..42052 + 153 WP_001331364.1 Hok/Gef family protein Toxin
PIC49_RS24805 (42124) 42124..42375 - 252 WP_001291964.1 hypothetical protein -
PIC49_RS24810 (42876) 42876..42971 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PIC49_RS24815 (43036) 43036..43212 - 177 WP_001054900.1 hypothetical protein -
PIC49_RS24820 (43544) 43544..43753 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
PIC49_RS24825 (43825) 43825..44487 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
PIC49_RS24830 (44558) 44558..46726 - 2169 WP_023518847.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87625 87625


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T267831 WP_001331364.1 NZ_CP116076:41900-42052 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT267831 NZ_CP116076:c41850-41788 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References