Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 739028..739721 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PIC49_RS03590 | Protein ID | WP_000415584.1 |
Coordinates | 739028..739324 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PIC49_RS03595 | Protein ID | WP_000650107.1 |
Coordinates | 739326..739721 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS03555 (734107) | 734107..734421 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
PIC49_RS03560 (734452) | 734452..735033 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
PIC49_RS03565 (735361) | 735361..735693 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
PIC49_RS03570 (735739) | 735739..737088 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PIC49_RS03575 (737085) | 737085..737744 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
PIC49_RS03580 (737896) | 737896..738288 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PIC49_RS03585 (738341) | 738341..738823 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PIC49_RS03590 (739028) | 739028..739324 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PIC49_RS03595 (739326) | 739326..739721 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PIC49_RS03600 (739854) | 739854..741461 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PIC49_RS03605 (741599) | 741599..743857 | + | 2259 | WP_022646133.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T267813 WP_000415584.1 NZ_CP116074:739028-739324 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT267813 WP_000650107.1 NZ_CP116074:739326-739721 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|