Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 633275..634074 | Replicon | chromosome |
| Accession | NZ_CP116074 | ||
| Organism | Escherichia coli strain DETEC-S586 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | B7NDB6 |
| Locus tag | PIC49_RS03065 | Protein ID | WP_000347269.1 |
| Coordinates | 633275..633739 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V0YUB5 |
| Locus tag | PIC49_RS03070 | Protein ID | WP_001309780.1 |
| Coordinates | 633739..634074 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC49_RS03035 (628276) | 628276..628710 | - | 435 | WP_000948818.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PIC49_RS03040 (628728) | 628728..629606 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PIC49_RS03045 (629596) | 629596..630375 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PIC49_RS03050 (630386) | 630386..630859 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PIC49_RS03055 (630882) | 630882..632162 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PIC49_RS03060 (632411) | 632411..633220 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| PIC49_RS03065 (633275) | 633275..633739 | - | 465 | WP_000347269.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PIC49_RS03070 (633739) | 633739..634074 | - | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PIC49_RS03075 (634223) | 634223..635794 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| PIC49_RS03080 (636169) | 636169..637503 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PIC49_RS03085 (637519) | 637519..638289 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T267811 WP_000347269.1 NZ_CP116074:c633739-633275 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829IY86 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0YUB5 |