Detailed information of TA system TA267806

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 91667..92093
• Replicon: plasmid pDETEC77
• Accession: NZ_CP116072
• Organism: Escherichia coli strain DETEC-S589

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC30_RS26330
• Protein ID: WP_001372321.1
• Coordinates: 91667..91792 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	91869..92093 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC30_RS26290 (87041)	87041..87730	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIC30_RS26295 (87917)	87917..88300	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC30_RS26300 (88621)	88621..89223	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PIC30_RS26305 (89520)	89520..90341	-	822	WP_001234426.1	DUF932 domain-containing protein	-
PIC30_RS26310 (90459)	90459..90746	-	288	WP_000107535.1	hypothetical protein	-
PIC30_RS26315 (90771)	90771..90977	-	207	WP_000547968.1	hypothetical protein	-
PIC30_RS26320 (91047)	91047..91219	+	173	Protein_102	hypothetical protein	-
PIC30_RS26325 (91217)	91217..91447	-	231	WP_071586998.1	hypothetical protein	-
PIC30_RS26330 (91667)	91667..91792	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC30_RS26335 (91734)	91734..91883	-	150	Protein_105	plasmid maintenance protein Mok	-
- (91869)	91869..92093	-	225	NuclAT_0	-	Antitoxin
- (91869)	91869..92093	-	225	NuclAT_0	-	Antitoxin
- (91869)	91869..92093	-	225	NuclAT_0	-	Antitoxin
- (91869)	91869..92093	-	225	NuclAT_0	-	Antitoxin
PIC30_RS26340 (91905)	91905..92093	+	189	WP_001299721.1	hypothetical protein	-
PIC30_RS26345 (92062)	92062..92824	-	763	Protein_107	plasmid SOS inhibition protein A	-
PIC30_RS26350 (92821)	92821..93255	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PIC30_RS26355 (93310)	93310..93507	-	198	Protein_109	hypothetical protein	-
PIC30_RS26360 (93535)	93535..93768	-	234	WP_000005987.1	DUF905 family protein	-
PIC30_RS26365 (93836)	93836..94375	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
PIC30_RS26370 (94401)	94401..94607	-	207	WP_000275856.1	hypothetical protein	-
PIC30_RS26375 (94677)	94677..94757	+	81	Protein_113	hypothetical protein	-
PIC30_RS26380 (94940)	94940..95109	-	170	Protein_114	hypothetical protein	-
PIC30_RS26385 (95746)	95746..96717	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(B) / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..132207	132207

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267806 WP_001372321.1 NZ_CP116072:c91792-91667 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT267806 NZ_CP116072:c92093-91869 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin