Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53338..53592 | Replicon | plasmid pDETEC77 |
| Accession | NZ_CP116072 | ||
| Organism | Escherichia coli strain DETEC-S589 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC30_RS26095 | Protein ID | WP_001312851.1 |
| Coordinates | 53338..53487 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 53531..53592 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC30_RS26050 (48890) | 48890..49291 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PIC30_RS26055 (49224) | 49224..49481 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PIC30_RS26060 (49574) | 49574..50227 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PIC30_RS26065 (50325) | 50325..50465 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| PIC30_RS26070 (51166) | 51166..52023 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PIC30_RS26075 (52016) | 52016..52498 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC30_RS26080 (52491) | 52491..52538 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC30_RS26085 (52529) | 52529..52780 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC30_RS26090 (52797) | 52797..53054 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC30_RS26095 (53338) | 53338..53487 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (53531) | 53531..53592 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (53531) | 53531..53592 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (53531) | 53531..53592 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (53531) | 53531..53592 | + | 62 | NuclAT_1 | - | Antitoxin |
| PIC30_RS26100 (53848) | 53848..53922 | - | 75 | Protein_58 | endonuclease | - |
| PIC30_RS26105 (54168) | 54168..54380 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC30_RS26110 (54516) | 54516..55076 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC30_RS26115 (55179) | 55179..56039 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| PIC30_RS26120 (56098) | 56098..56844 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(B) / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..132207 | 132207 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T267801 WP_001312851.1 NZ_CP116072:c53487-53338 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT267801 NZ_CP116072:53531-53592 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
