Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5012570..5013172 | Replicon | chromosome |
Accession | NZ_CP116071 | ||
Organism | Escherichia coli strain DETEC-S589 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | PIC30_RS24785 | Protein ID | WP_000897302.1 |
Coordinates | 5012861..5013172 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC30_RS24780 | Protein ID | WP_000356397.1 |
Coordinates | 5012570..5012860 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC30_RS24755 (5008643) | 5008643..5009545 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PIC30_RS24760 (5009542) | 5009542..5010177 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PIC30_RS24765 (5010174) | 5010174..5011103 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
PIC30_RS24770 (5011319) | 5011319..5011537 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
PIC30_RS24775 (5011933) | 5011933..5012211 | - | 279 | WP_001296612.1 | hypothetical protein | - |
PIC30_RS24780 (5012570) | 5012570..5012860 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIC30_RS24785 (5012861) | 5012861..5013172 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
PIC30_RS24790 (5013401) | 5013401..5014309 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
PIC30_RS24795 (5014373) | 5014373..5015314 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PIC30_RS24800 (5015359) | 5015359..5015796 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PIC30_RS24805 (5015793) | 5015793..5016665 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIC30_RS24810 (5016659) | 5016659..5017258 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T267800 WP_000897302.1 NZ_CP116071:c5013172-5012861 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|