Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4256041..4256299 | Replicon | chromosome |
Accession | NZ_CP116071 | ||
Organism | Escherichia coli strain DETEC-S589 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PIC30_RS21185 | Protein ID | WP_000809168.1 |
Coordinates | 4256147..4256299 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4256041..4256098 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC30_RS21170 | 4251873..4253132 | - | 1260 | WP_271287397.1 | cytoplasmic protein | - |
PIC30_RS21175 | 4253261..4254754 | - | 1494 | WP_001350775.1 | sulfatase-like hydrolase/transferase | - |
PIC30_RS21180 | 4254774..4255535 | - | 762 | WP_001274823.1 | outer membrane protein OmpK | - |
- | 4256041..4256098 | - | 58 | - | - | Antitoxin |
PIC30_RS21185 | 4256147..4256299 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
PIC30_RS21190 | 4256404..4257534 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
PIC30_RS21195 | 4257623..4259539 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PIC30_RS21200 | 4259911..4260315 | + | 405 | WP_000843687.1 | DUF2541 family protein | - |
PIC30_RS21205 | 4260341..4261054 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T267796 WP_000809168.1 NZ_CP116071:4256147-4256299 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT267796 NZ_CP116071:c4256098-4256041 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|