Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3987046..3987740 | Replicon | chromosome |
Accession | NZ_CP116071 | ||
Organism | Escherichia coli strain DETEC-S589 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PIC30_RS19935 | Protein ID | WP_001263500.1 |
Coordinates | 3987046..3987444 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC30_RS19940 | Protein ID | WP_000554758.1 |
Coordinates | 3987447..3987740 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC30_RS19910 (3982411) | 3982411..3982869 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
PIC30_RS19915 (3983130) | 3983130..3984587 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
PIC30_RS19920 (3984644) | 3984644..3985258 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
PIC30_RS19925 (3985255) | 3985255..3986394 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
PIC30_RS19930 (3986584) | 3986584..3987036 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
PIC30_RS19935 (3987046) | 3987046..3987444 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC30_RS19940 (3987447) | 3987447..3987740 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC30_RS19945 (3987792) | 3987792..3988847 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
PIC30_RS19950 (3988918) | 3988918..3989703 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC30_RS19955 (3989675) | 3989675..3991387 | + | 1713 | Protein_3911 | flagellar biosynthesis protein FlhA | - |
PIC30_RS19960 (3991466) | 3991466..3991624 | + | 159 | WP_014639450.1 | hypothetical protein | - |
PIC30_RS19965 (3991707) | 3991707..3992204 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3987046..4007400 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T267795 WP_001263500.1 NZ_CP116071:c3987444-3987046 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|